RegulonDB RegulonDB 11.0: Amino acid Sequence
ribonuclease BN Amino Acid Sequence


Size: 305

Fasta

 

>ribonuclease BN E. coli K12. Version NC_000913.3 GI:556503834
MELIFLGTSAGVPTRTRNVTAILLNLQHPTQSGLWLFDCGEGTQHQLLHTAFNPGKLDKI
FISHLHGDHLFGLPGLLCSRSMSGIIQPLTIYGPQGIREFVETALRISGSWTDYPLEIVE
IGAGEILDDGLRKVTAYPLEHPLECYGYRIEEHDKPGALNAQALKAAGVPPGPLFQELKA
GKTITLEDGRQINGADYLAAPVPGKALAIFGDTGPCDAALDLAKGVDVMVHEATLDITME
AKANSRGHSSTRQAATLAREAGVGKLIITHVSSRYDDKGCQHLLRECRSIFPATELANDF
TVFNV
              
                            

Download fasta file
RegulonDB