RegulonDB RegulonDB 11.0: Amino acid Sequence
DUF1877 domain-containing protein YfbM Amino Acid Sequence


Size: 167

Fasta

 

>DUF1877 domain-containing protein YfbM E. coli K12. Version NC_000913.3 GI:556503834
MGMIGYFAEIDSEKINQLLESTEKPLMDNIHDTLSGLRRLDIDKRWDFLHFGLTGTSAFD
PAKNDPLSRAVLGEHSLEDGIDGFLGLTWNQELAATIDRLESLDRNELRKQFSIKRLNEM
EIYPGVTFSEELEGQLFASIMLDMEKLISAYRRMLRQGNHALTVIVG
              
                            

Download fasta file
RegulonDB