RegulonDB RegulonDB 11.0: Amino acid Sequence
uncharacterized protein YfbN Amino Acid Sequence


Size: 238

Fasta

 

>uncharacterized protein YfbN E. coli K12. Version NC_000913.3 GI:556503834
MEWLSEIRKLRKNVPVGIQVARRLLERTGGDVDEAIKLFHIDQINILTAKADVTHQEAEN
VLLATNYDIAEALRRIDEQRYTLTELILRKNKDAGDALNNIALAIEYEWDLKRKFWFGFA
DIQLLPPVLQTFMLVYEWHEYVGWEGMECGIFFESDHTHQQLQALGLLELAQKMVTARIR
YDELKDKAENFHEITEDDIFKMLIIHCDQLAREVDSILLQFVKDNIDVFPCRHNRHEL
              
                            

Download fasta file
RegulonDB