RegulonDB RegulonDB 10.9: Amino acid Sequence
uncharacterized protein YfbO Amino Acid Sequence


Size: 140

Fasta

 

>uncharacterized protein YfbO E. coli K12. Version NC_000913.3 GI:556503834
MTPLERITQLVNINGDVNNPDTPRPLLSLEDFFIDNNIHGSICCNVIPEQSPQAIYHHFL
KIRERNNVSDVLVEITMFDDPDWPFSESILVITTASPEEVQSWFVEEIAPDECWEGWSED
TEHGWVEVPVGMHPVTCWWD
              
                            

Download fasta file
RegulonDB