RegulonDB RegulonDB 10.9: Amino acid Sequence
dCMP phosphohydrolase Amino Acid Sequence


Size: 199

Fasta

 

>dCMP phosphohydrolase E. coli K12. Version NC_000913.3 GI:556503834
MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
IFVPSFHLSLDEISQDSPL
              
                            

Download fasta file
RegulonDB