RegulonDB RegulonDB 10.9: Amino acid Sequence
putative transporter YfbS Amino Acid Sequence


Size: 610

Fasta

 

>putative transporter YfbS E. coli K12. Version NC_000913.3 GI:556503834
MNGELIWVLSLLAVAIVLFATGRVRMDAVALFVIVAFALSGTLTVPEVFSGFSDPNVVLI
AALFIIGDGLVRTGVATVMGTWLVKVAGNSEIKMLVLLMLTVAGLGAFMSSTGVVAIFIP
VVLSVAMRMQTSPSRLMMPLSFAGLISGMMTLVATPPNLVVNSELLREGYHGFSFFSVTP
IGLVVLVLGILYMLVMRFMLKGDTQTPQREGWTRRTFRDLIREYRLTGRARRLAIRPGSP
MIGQRLDDLKLRERYGANVIGVERWRRFRRVIVNVNGVSEFRARDVLLIDMSAADVDLRQ
FCSEQLLEPMVLRGEYFSDQALDVGMAEISLIPESELIGKSVREIGFRTRYGLNVVGLKR
NGVALEGSLADEPLLLGDIILVVGNWKLIGMLAKQGRDFVALNLPEEVSEASPAHSQAPH
AIFCLVLMVALMLTDEIPNPVAAIIACLLMGKFRCIDAESAYKSIHWPSIILIVGMMPFA
VALQKTGGVALAVKGLMDIGGGYGPHMMLGCLFVLSAVIGLFISNTATAVLMAPIALAAA
KTMGVSPYPFAMVVAMAASAAFMTPVSSPVNTLVLGPGNYSFSDFVKLGVPFTIIVMAVC
VVMIPMLFPF
              
                            

Download fasta file
RegulonDB