RegulonDB RegulonDB 10.9: Amino acid Sequence
UPF0208 membrane protein YfbV Amino Acid Sequence


Size: 151

Fasta

 

>UPF0208 membrane protein YfbV E. coli K12. Version NC_000913.3 GI:556503834
MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLC
WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVL
APVEGKPDYQALADTLKRAFKQLDKTFLDDL
              
                            

Download fasta file
RegulonDB