RegulonDB RegulonDB 10.8: Amino acid Sequence
PF08891 family protein YfcL Amino Acid Sequence


Size: 92

Fasta

 

>PF08891 family protein YfcL E. coli K12. Version NC_000913.3 GI:556503834
MIAEFESRILALIDGMVDHASDDELFASGYLRGHLTLAIAELESGDDHSAQAVHTTVSQS
LEKAIGAGELSPRDQALVTDMWENLFQQASQQ
              
                            

Download fasta file
RegulonDB