RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF406 domain-containing protein YfcZ Amino Acid Sequence


Size: 94

Fasta

 

>DUF406 domain-containing protein YfcZ E. coli K12. Version NC_000913.3 GI:556503834
MSKCSADETPVCCCMDVGTIMDNSDCTASYSRVFANRAEAEQTLAALTEKARSVESEPCK
ITPTFTEESDGVRLDIDFTFACEAEMLIFQLGLR
              
                            

Download fasta file
RegulonDB