RegulonDB RegulonDB 10.9: Amino acid Sequence
CPS-53 (KpLE1) prophage; bactoprenol glucosyl transferase Amino Acid Sequence


Size: 306

Fasta

 

>CPS-53 (KpLE1) prophage; bactoprenol glucosyl transferase E. coli K12. Version NC_000913.3 GI:556503834
MKISLVVPVFNEEEAIPIFYKTVREFEELKSYEVEIVFINDGSKDATESIINALAVSDPL
VVPLSFTRNFGKEPALFAGLDHATGDAIIPIDVDLQDPIEVIPHLIEKWQAGADMVLAKR
SDRSTDGRLKRKTAEWFYKLHNKISNPKIEENVGDFRLMSRDVVENIKLMPERNLFMKGI
LSWVGGKTDIVEYVRAERIAGDTKFNGWKLWNLALEGITSFSTFPLRIWTYIGLVVASVA
FIYGAWMILDTIIFGNAVRGYPSLLVSILFLGGIQMIGIGVLGEYIGRTYIETKKRPKYI
IKRVKK
              
                            

Download fasta file
RegulonDB