RegulonDB RegulonDB 10.10: Amino acid Sequence
CPS-53 (KpLE1) prophage; uncharacterized protein YfdN Amino Acid Sequence


Size: 164

Fasta

 

>CPS-53 (KpLE1) prophage; protein YzyA E. coli K12. Version NC_000913.3 GI:556503834
MSMSLLNDVQKFIEAHPGCTSGDIADAFAGYSRQRVLQSASKLRQSGRVAHRCEGDTHRH
FPRLTERAQDPEPQPVRETRPVRNFYVGTNDPRVILCLTRQAEELESRGLYRRAATVWMA
AFRESHSQPERNNFLARRERCLRKSSKRAASGEEWYLSGNYVGA
              
                            

Download fasta file
RegulonDB