RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF2502 domain-containing protein YpeC Amino Acid Sequence


Size: 108

Fasta

 

>DUF2502 domain-containing protein YpeC E. coli K12. Version NC_000913.3 GI:556503834
MFRSLFLAAALMAFTPLAANAGEITLLPSIKLQIGDRDHYGNYWDGGHWRDRDYWHRNYE
WRKNRWWRHDNGYHRGWDKRKAYERGYREGWRDRDDHRGKGRGHGHRH
              
                            

Download fasta file
RegulonDB