RegulonDB RegulonDB 10.8: Amino acid Sequence
putative outer membrane porin YfeN Amino Acid Sequence


Size: 254

Fasta

 

>putative outer membrane porin YfeN E. coli K12. Version NC_000913.3 GI:556503834
MKKHLLTLTLSSILAIPVVSHAEFKGGFADIGVHYLDWTSRTTEKSSTKSHKDDFGYLEF
EGGANFSWGEMYGFFDWENFYNGRHNKPGSEQRYTFKNTNRIYLGDTGFNLYLHAYGTYG
SANRVNFHDDMFLYGIGYNFTGSGWWFKPFFAKRYTDQTYYTGDNGYVAGWVAGYNFMLG
SEKFTLTNWNEYEFDRDATYAAGNGGKEGLNGAVALWWNATSHITTGIQYRYADDKLGED
FYQDAIIYSIKFNF
              
                            

Download fasta file
RegulonDB