RegulonDB RegulonDB 10.9: Amino acid Sequence
PF05406 family protein YfeS Amino Acid Sequence


Size: 244

Fasta

 

>PF05406 family protein YfeS E. coli K12. Version NC_000913.3 GI:556503834
MKKRFIYHDEKSNKFWWIDYEGDSLAVNYGKVGSIGKFQTKEFDNEEQCLKEASKLIAAK
MKKGYQEDPKFNFMDRYYFDDEEIGLHVKTSHPNFQCHFTDPLYMCCWDEESPFGSDEGA
DALNVLENSLRKEPDLDCADFPQMLIETMWGMKYIAMDSILEEDVRAQLLVDEMSTIQSN
MITYATAFGQIKVMGKISHKLKKMGLNALARHQLTAKILQWGDGQDSPILQKMIDDLTAF
PHEN
              
                            

Download fasta file
RegulonDB