RegulonDB RegulonDB 10.9: Amino acid Sequence
N-acetylmuramic acid-specific PTS enzyme IICB component / anhydro-N-acetylmuramic acid transporter Amino Acid Sequence


Size: 474

Fasta

 

>N-acetylmuramic acid-specific PTS enzyme IICB component / anhydro-N-acetylmuramic acid transporter E. coli K12. Version NC_000913.3 GI:556503834
MAKEISSELLNTILTRVGGPGNIASCGNCMTRLRLGVHDSSLVDPNIKTLEGVKGVILTS
DQVQVVFGPGKAHRAAKAMSELLGEAPVQDAAEIAAQNKRQLKAKQTSGVQQFLAKFATI
FTPLIPGFIAAGLLLGIATLIATVMHVPADAQGTLPDALNFMKVFSKGLFTFLVILVGYN
AAQAFGGTGVNGAIIAALFLLGYNPAATTGYYAGFHDFFGLPIDPRGNIIGVLIAAWACA
RIEGMVRRFMPDDLDMLLTSLITLLITATLAYLIIMPLGGWLFEGMSWLFMHLNSNPFGC
AVLAGLFLIAVVFGVHQGFIPVYLALMDSQGFNSLFPILSMAGAGQVGAALALYWRAQPH
SALRSQVRGAIIPGLLGVGEPLIYGVTLPRMKPFVTACLGGAAGGLFIGLIAWWGLPMGL
NSAFGPSGLVALPLMTSAQGILPAMAVYAGGILVAWVCGFIFTTLFGCRNVNLD
              
                            

Download fasta file
RegulonDB