RegulonDB RegulonDB 10.9: Amino acid Sequence
CPZ-55 prophage; uncharacterized protein YffP Amino Acid Sequence


Size: 197

Fasta

 

>CPZ-55 prophage; uncharacterized protein YffP E. coli K12. Version NC_000913.3 GI:556503834
MSLIRTETRDTKRAADPLHDLRSKPFSEWGEDEIRRFNLIDALLEFVYTDTSSPFGIGMT
FDYTECWEIGVRDDCLVMTRVKPVHPEYAKHWNMKGVMNDKTRFHADKWVGYSKVLAWVS
LSHKDTFTGAKRFQYFQTMYDMERQINANLPVGGLPNVDTERTGKLFQRDDFSEDSHAND
PKLVGDDYVPQAPEQIN
              
                            

Download fasta file
RegulonDB