RegulonDB RegulonDB 11.0: Amino acid Sequence
CPZ-55 prophage; uncharacterized protein YffR Amino Acid Sequence


Size: 130

Fasta

 

>CPZ-55 prophage; uncharacterized protein YffR E. coli K12. Version NC_000913.3 GI:556503834
MKVLGNILWWAFVGFMAYATLIKPDNTDPAVVNYEEPLPMELANYGEPGEGAKIMNAAKI
MGRDYAWKHVKEDRLPCLFAAGVVADNILVKYHFSNETEFKLKAAAVRECANVAENNGFV
LVGRVFEKRN
              
                            

Download fasta file
RegulonDB