RegulonDB RegulonDB 10.8: Amino acid Sequence
CPZ-55 prophage; uncharacterized protein YffS Amino Acid Sequence


Size: 269

Fasta

 

>CPZ-55 prophage; uncharacterized protein YffS E. coli K12. Version NC_000913.3 GI:556503834
MSYEIKICDILKGAAMEGQYKGAQRGAKCEEIANELTRRGVKNNKGEVITKGGVSHWLEG
RREPNFDTLAELCDMFGVYALMPMRGGKWIRVHPEDRGEMELREAVAERDAIIDDLKARI
AELEAALANKQVPAEAEEMGGEKVEEVAAEQAPNDEKEMGAKEWVNPNPKKYSVGMLCQV
LAAMGGEYLGNNAGLQQKITVLDNDGNRKPISNGAFYRLIEQAKGRGLISVEQEIKHKKD
ENGNQIGKGKKGDKLITLLPNWIDKLGDE
              
                            

Download fasta file
RegulonDB