RegulonDB RegulonDB 10.10: Amino acid Sequence
putative ethanolamine catabolic microcompartment shell protein EutM Amino Acid Sequence


Size: 97

Fasta

 

>putative ethanolamine catabolic microcompartment shell protein EutM E. coli K12. Version NC_000913.3 GI:556503834
MEALGMIETRGLVALIEASDAMVKAARVKLVGVKQIGGGLCTAMVRGDVAACKAATDAGA
AAAQRIGELVSVHVIPRPHGDLEEVFPIGLKGDSSNL
              
                            

Download fasta file
RegulonDB