RegulonDB RegulonDB 10.8: Amino acid Sequence
phosphate acetyltransferase EutD Amino Acid Sequence


Size: 338

Fasta

 

>phosphate acetyltransferase EutD E. coli K12. Version NC_000913.3 GI:556503834
MIIERCRELALRAPARVVFPDALDQRVLKAAQYLHQQGLATPILVANPFELRQFALSHGV
AMDGLQVIDPHGNLAMREEFAHRWLARAGEKTPPDALEKLTDPLMFAAAMVSAGKADVCI
AGNLSSTANVLRAGLRIIGLQPGCKTLSSIFLMLPQYSGPALGFADCSVVPQPTAAQLAD
IALASAETWRAITGEEPRVAMLSFSSNGSARHPCVANVQQATEIVRERAPKLVVDGELQF
DAAFVPEVAAQKAPASPLQGKANVMVFPSLEAGNIGYKIAQRLGGYRAVGPLIQGLAAPM
HDLSRGCSVQEIIELALVAAVPRQTEVNRESSLQTLVE
              
                            

Download fasta file
RegulonDB