RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF1176 domain-containing protein YpfG Amino Acid Sequence


Size: 347

Fasta

 

>DUF1176 domain-containing protein YpfG E. coli K12. Version NC_000913.3 GI:556503834
MRYRIFLLFFFALLPTSLVWAAPAQRAFSDWQVTCNNQNFCVARNTGDHNGLVMTLSRSA
GAHTDAVLRIERGGLKSPEASEGEIAPRLLLDGEPLALSGDKWRISPWLLVTDDTATITA
FLQMIQEGKAITLRDGDQTISLSGLKAALLFIDAQQKRVGSETAWIKKGDEPPLSVPPAP
ALKEVAVVNPTPTPLSLEERNDLLDYGNWRMNGLRCSLDPLRREVNVTALTDDKALMMIS
CEAGAYNTIDLAWIVSRKKPLASRPVRLRLPFNNGQETNELELMNATFDEKSRELVTLAK
GRGLSDCGIQARWRFDGQRFRLVRYAAEPTCDNWHGPDAWPTLWITR
              
                            

Download fasta file
RegulonDB