RegulonDB RegulonDB 10.9: Amino acid Sequence
uncharacterized protein YpfJ Amino Acid Sequence


Size: 287

Fasta

 

>uncharacterized protein YpfJ E. coli K12. Version NC_000913.3 GI:556503834
MRWQGRRESDNVEDRRNSSGGPSMGGPGFRLPSGKGGLILLIVVLVAGYYGVDLTGLMTG
QPVSQQQSTRSISPNEDEAAKFTSVILATTEDTWGQQFEKMGKTYQQPKLVMYRGMTRTG
CGAGQSIMGPFYCPADGTVYIDLSFYDDMKDKLGADGDFAQGYVIAHEVGHHVQKLLGIE
PKVRQLQQNATQAEVNRLSVRMELQADCFAGVWGHSMQQQGVLETGDLEEALNAAQAIGD
DRLQQQSQGRVVPDSFTHGTSQQRYSWFKRGFDSGDPAQCNTFGKSI
              
                            

Download fasta file
RegulonDB