RegulonDB RegulonDB 10.9: Amino acid Sequence
hydrogenase 4 catalytic subunit HyfI Amino Acid Sequence


Size: 252

Fasta

 

>hydrogenase 4 catalytic subunit HyfI E. coli K12. Version NC_000913.3 GI:556503834
MSPVLTQHVSQPITLDEQTQKMKRHLLQDIRRSAYVYRVDCGGCNACEIEIFAAITPVFD
AERFGIKVVSSPRHADILLFTGAVTRAMRMPALRAYESAPDHKICVSYGACGVGGGIFHD
LYSVWGGSDTIVPIDVWIPGCPPTPAATIHGFAVALGLLQQKIHAVDYRDPTGVTMQPLW
PQIPPSQRIAIEREARRLAGYRQGREICDRLLRHLSDDPTGNRVNTWLRDADDPRLNSIV
QQLFRVLRGLHD
              
                            

Download fasta file
RegulonDB