RegulonDB RegulonDB 10.9: Amino acid Sequence
inibitor of reinitiation of DNA replication Amino Acid Sequence


Size: 233

Fasta

 

>inibitor of reinitiation of DNA replication E. coli K12. Version NC_000913.3 GI:556503834
MNTPAQLSLPLYLPDDETFASFWPGDNSSLLAALQNVLRQEHSGYIYLWAREGAGRSHLL
HAACAELSQRGDAVGYVPLDKRTWFVPEVLDGMEHLSLVCIDNIECIAGDELWEMAIFDL
YNRILESGKTRLLITGDRPPRQLNLGLPDLASRLDWGQIYKLQPLSDEDKLQALQLRARL
RGFELPEDVGRFLLKRLDREMRTLFMTLDQLDRASITAQRKLTIPFVKEILKL
              
                            

Download fasta file
RegulonDB