RegulonDB RegulonDB 10.9: Amino acid Sequence
nickel/cobalt stress response protein YfgG Amino Acid Sequence


Size: 63

Fasta

 

>nickel/cobalt stress response protein YfgG E. coli K12. Version NC_000913.3 GI:556503834
MSQATSMRKRHRFNSRMTRIVLLISFIFFFGRFIYSSVGAWQHHQSKKEAQQSTLSVESP
VQR
              
                            

Download fasta file
RegulonDB