RegulonDB RegulonDB 10.9: Amino acid Sequence
lipoprotein YfgH Amino Acid Sequence


Size: 172

Fasta

 

>lipoprotein YfgH E. coli K12. Version NC_000913.3 GI:556503834
MMKFKKCLLPVAMLASFTLAGCQSNADDHAADVYQTDQLNTKQETKTVNIISILPAKVAV
DNSQNKRNAQAFGALIGAVAGGVIGHNVGSGSNSGTTAGAVGGGAVGAAAGSMVNDKTLV
EGVSLTYKEGTKVYTSTQVGKECQFTTGLAVVITTTYNETRIQPNTKCPEKS
              
                            

Download fasta file
RegulonDB