RegulonDB RegulonDB 10.9: Amino acid Sequence
nalidixic acid resistance protein YfgI Amino Acid Sequence


Size: 179

Fasta

 

>nalidixic acid resistance protein YfgI E. coli K12. Version NC_000913.3 GI:556503834
MKKVFLCAILASLSYPAIASSLQDQLSAVAEAEQQGKNEEQRQHDEWVAERNREIQQEKQ
RRANAQAAANKRAATAAANKKARQDKLDAEASADKKRDQSYEDELRSLEIQKQKLALAKE
EARVKRENEFIDQELKHKAAQTDVVQSEADANRNMTEGGRDLMKSVGKAEENKSDSWFN
              
                            

Download fasta file
RegulonDB