RegulonDB RegulonDB 10.9: Amino acid Sequence
scaffold protein for iron-sulfur cluster assembly Amino Acid Sequence


Size: 128

Fasta

 

>scaffold protein for iron-sulfur cluster assembly E. coli K12. Version NC_000913.3 GI:556503834
MAYSEKVIDHYENPRNVGSFDNNDENVGSGMVGAPACGDVMKLQIKVNDEGIIEDARFKT
YGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIAEELELPPVKIHCSILAEDAIKAAIAD
YKSKREAK
              
                            

Download fasta file
RegulonDB