RegulonDB RegulonDB 10.9: Amino acid Sequence
putative 3-phenylpropionate transporter Amino Acid Sequence


Size: 379

Fasta

 

>putative 3-phenylpropionate transporter E. coli K12. Version NC_000913.3 GI:556503834
MVLQSTRWLALGYFTYFFSYGIFLPFWSVWLKGIGLTPETIGLLLGAGLVARFLGSLLIA
PRVSDPSRLISALRVLALLTLLFAVAFWAGAHVAWLMLVMIGFNLFFSPLVPLTDALANT
WQKQFPLDYGKVRLWGSVAFVIGSALTGKLVTMFDYRVILALLTLGVASMLLGFLIRPTI
QPQGASRQQESTGWSAWLALVRQNWRFLACVCLLQGAHAAYYGFSAIYWQAAGYSASAVG
YLWSLGVVAEVIIFALSNKLFRRCSARDMLLISAICGVVRWGIMGATTALPWLIVVQILH
CGTFTVCHLAAMRYIAARQGSEVIRLQAVYSAVAMGGSIAIMTVFAGFLYQYLGHGVFWV
MALVALPAMFLRPKVVPSC
              
                            

Download fasta file
RegulonDB