RegulonDB RegulonDB 10.8: Amino acid Sequence
putative 4Fe-4S cluster-containing protein YfhL Amino Acid Sequence


Size: 86

Fasta

 

>putative 4Fe-4S cluster-containing protein YfhL E. coli K12. Version NC_000913.3 GI:556503834
MALLITKKCINCDMCEPECPNEAISMGDHIYEINSDKCTECVGHYETPTCQKVCPIPNTI
VKDPAHVETEEQLWDKFVLMHHADKI
              
                            

Download fasta file
RegulonDB