RegulonDB RegulonDB 10.9: Amino acid Sequence
protein RseC Amino Acid Sequence


Size: 159

Fasta

 

>protein RseC E. coli K12. Version NC_000913.3 GI:556503834
MIKEWATVVSWQNGQALVSCDVKASCSSCASRAGCGSRVLNKLGPQTTHTIVVPCDEPLV
PGQKVELGIAEGSLLSSALLVYMSPLVGLFLIASLFQLLFASDVAALCGAILGGIGGFLI
ARGYSRKFAARAEWQPIILSVALPPGLVRFETSSEDASQ
              
                            

Download fasta file
RegulonDB