RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF4154 domain-containing protein YfiR Amino Acid Sequence


Size: 172

Fasta

 

>DUF4154 domain-containing protein YfiR E. coli K12. Version NC_000913.3 GI:556503834
MRFSHRLFLLLILLLTGAPILAQEPSDVAKNVRMMVSGIVSYTRWPALSGPPKLCIFSSS
RFSTALQENAATSLPYLPVIIHTQQEAMISGCNGFYFGNESPTFQMELTEQYPSKALLLI
AEQNTECIIGSAFCLIIHNNDVRFAVNLDALSRSGVKVNPDVLMLARKKNDG
              
                            

Download fasta file
RegulonDB