RegulonDB RegulonDB 10.9: Amino acid Sequence
putative component of the Rsx system Amino Acid Sequence


Size: 96

Fasta

 

>putative component of the Rsx system E. coli K12. Version NC_000913.3 GI:556503834
MPGKIAVEVAYALPEKQYLQRVTLQEGATVEEAIRASGLLELRTDIDLTKNKVGIYSRPA
KLSDSVHDGDRVEIYRPLIADPKELRRQRAEKSANK
              
                            

Download fasta file
RegulonDB