RegulonDB RegulonDB 10.8: Amino acid Sequence
CP4-57 prophage; anti-bacteriophage protein Amino Acid Sequence


Size: 538

Fasta

 

>CP4-57 prophage; anti-bacteriophage protein E. coli K12. Version NC_000913.3 GI:556503834
MESNDSGGVAAKHGFLFQDCVAAYHVTRMLRDKTIRSVRCEVTDDIDIVSDGYIDFVQVK
STGKTRWNISDIVQNSKGADKKTIPCSSILHKSMQCESDLSLGRRYSIVTEEKVNKTLEY
LTISPNARLDKPGRQELIDDLNKRTDNFLTDSGISVSDWIDAATWEVFSSLRELELLGIK
NIRLASQDLHGVILSSETVAEDIWCRILDTVTRKGEHSRRIHSADDKSYLRPDLLEWFKQ
RVEDDQSRSGRKIYVKRDLPHILTPFRAPMASVCAKRKGQVLHQQYSLKKYRYKHIADNV
CQWLDEVFLRPKEMSDIHKLTFIEKRERLKNSVFKSLHDVSEFLGRVLLHATIRQHHESQ
PIPCMLYVEKAGAEKILENVHIVRRDPEGDQLWIGFSELVTDINIAVRLPEIRDQLYEDI
SDCIDTARKKILDIKDDNYLLRHDIDEILDGSQPFDAHLDRFTFVLFVGYDSNLLTEPET
PGFEDDLEKETAVLFEKFAADLIEDSPFANLCIHVFIYPAPSLERLTQLVDEKVREVV
              
                            

Download fasta file
RegulonDB