RegulonDB RegulonDB 10.8: Amino acid Sequence
CP4-57 prophage; putative GTP-binding protein YfjP Amino Acid Sequence


Size: 287

Fasta

 

>CP4-57 prophage; putative GTP-binding protein YfjP E. coli K12. Version NC_000913.3 GI:556503834
MKNFEVLQPLQNSLSGLPLWVSERILQQINQLTHYEPVIGIMGKTGAGKSSLCNALFAGE
VSPVSDVAACTRDPLRFRLQIGEHFMTIVDLPGVGESGVRDTEYAALYREQLPRLDLILW
LIKADDRALATDEHFYRQVIGEAYRHKMLFVISQSDKAEPTSGGNILSTEQKQNISRKIC
LLHELFQPVHPVCAVSVRLQWGLRVMAERMIKCLPREASSPVVALLQHPFRTTVAREQAR
DDFGETVGAILDTVSTFPLIPAPVRTIIQAVRSSVVSVARAVWDFFF
              
                            

Download fasta file
RegulonDB