RegulonDB RegulonDB 10.10: Amino acid Sequence
CP4-57 prophage; uncharacterized protein YpjK Amino Acid Sequence


Size: 78

Fasta

 

>CP4-57 prophage; uncharacterized protein YpjK E. coli K12. Version NC_000913.3 GI:556503834
MPVIAIIAIVIIVIILNKTGVSDSLTALTLATVAALLTGGGAAGAASVALTPFVGVPVGI
FVGIYVFAKVVRLISGKK
              
                            

Download fasta file
RegulonDB