RegulonDB RegulonDB 10.9: Amino acid Sequence
CP4-57 prophage; uncharacterized protein YfjT Amino Acid Sequence


Size: 155

Fasta

 

>CP4-57 prophage; uncharacterized protein YfjT E. coli K12. Version NC_000913.3 GI:556503834
MKIRSLSRFVLASTMFASFTASAVPGLWQQGYGQGNAEYSVTDASGKMFTINCTGNPDQN
GIYQHSVFLILAGDKTVSSHDDSTGITVVMDHKQYAIPSTLGWRNGDNAWFSFIMDIRKA
RQFDVYVNDQKVGSFNPDVRNAQKVLPTLADCTND
              
                            

Download fasta file
RegulonDB