RegulonDB RegulonDB 10.10: Amino acid Sequence
CP4-57 prophage; putative arsenate reductase-like protein YfjU Amino Acid Sequence


Size: 104

Fasta

 

>CP4-57 prophage; ArsC family protein YfjU E. coli K12. Version NC_000913.3 GI:556503834
MSNITIYHNPACGTSRNTLEMLHNNGNEPTIINYLDMPPTRDELIKLISDIFSDKIIECI
REQCHLMPALSLNVIGHVDIRSIHSYLFNFNEKVSPSHGFIKNG
              
                            

Download fasta file
RegulonDB