RegulonDB RegulonDB 10.9: Amino acid Sequence
CP4-57 prophage; toxin of the YpjF-YfjZ toxin-antitoxin system Amino Acid Sequence


Size: 109

Fasta

 

>CP4-57 prophage; toxin of the YpjF-YfjZ toxin-antitoxin system E. coli K12. Version NC_000913.3 GI:556503834
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLA
DAVNFLVEKYELVRIDHRGFSWQQQSPYISVVDILRARRSTGLLKTNVK
              
                            

Download fasta file
RegulonDB