RegulonDB RegulonDB 10.9: Amino acid Sequence
putative uncharacterized protein YgaQ Amino Acid Sequence


Size: 750

Fasta

 

>putative uncharacterized protein YgaQ E. coli K12. Version NC_000913.3 GI:556503834
MFSIKPGPRNLPIDNPTLLSWNITDGDLNSKLNTLEYLNCITNIINSCGVYPQGLKDREI
ISTFHAEKVINDLLKNDYKISLSPDTTYRELNKAAQRSITAPDRIGERKT*VYQRDTMIE
RGDNSGVYQYGRAEHFTHIISDKPSPKDKYVAYAINIPDYELAADVYNINVTSPSGQQET
FKILINLEHLRQTLERKSLTAVQKSQCEIITPKKPGEAILHAFNATYQQIRENMSEFARC
HYGYIQIPPVTTFRADGPETPEEEKGYWFHAYQPEDLCTIHNPMGDLQDFIALVKDAKKF
GIDIIPDYTFNFMGIGGSGKNDLDYPSADIRAKISKDIEGGIPGY*QGQVLIPFIKDPVT
KERKQIHPEDIHLTAKDFEASKDNISKDEWENLHALKEKRLNGMPKTTPKSDQVIMLQNQ
YVREMRKYGVRGLRYDAAKHSKHEQIERSITPPLKNYNERLHNTNLFNPKYHKKAVMNYM
EYLVTCQLDEQQMSSLLYERDDLSAIDFSLLMKTIKAFSFGGDLQTLASKPGSTISSIPS
ERRILININHDFPNNGNLFNDFLFNHQQDEQLAMAYIAALPFSRPLVYWDGQVLKSTTEI
KNYDGSTRVGGEA*LNKGCSTYQQLYNEFHALYIDKAGIWSAFEGVSATKNVLAFSRGDS
VNINHSPHDGLVIINKGNEEVEGTWPNKLQPGIYKNMGSNSVNIIINNTRKIIPPGKVFT
LRGGTLNINIPGRSALLLGKTGEPPNYLYL
              
                            

Download fasta file
RegulonDB