RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF883 domain-containing protein YgaM Amino Acid Sequence


Size: 109

Fasta

 

>DUF883 domain-containing protein YgaM E. coli K12. Version NC_000913.3 GI:556503834
MFNRPNRNDVDDGVQDIQNDVNQLADSLESVLKSWGSDAKGEAEAARSKAQALLKETRAR
MHGRTRVQQAARDAVGCADSFVRERPWCSVGTAAAVGIFIGALLSMRKS
              
                            

Download fasta file
RegulonDB