RegulonDB RegulonDB 10.8: Amino acid Sequence
putative transporter YgaY, N-terminal fragment Amino Acid Sequence


Size: 391

Fasta

 

>putative transporter YgaY, N-terminal fragment E. coli K12. Version NC_000913.3 GI:556503834
MTKPNHELSPALIVLMSIATGLAVASNYYAQPLLDTIARNFSLSASSAGFIVTAAQLGYA
AGLLFLVPLGDMFERRRLIVSMTLLAAC*LPPAVSRWR**SSVRH*PVYSQSWHKFWFRW
QRRWLHRINAAKWLALL*AVCCWGSCWHGQLPDCWRISAAGAPSFGLLRC*WH*WRWHYG
VVCHK*NQKPTSTTHSCWVPFSVCLSAIKFCVPARCWAA*PLPISAFSGPQWPFCLPLHL
LTTAMVSLVCLDLRELPERWALVRRAVLPIRANRTTPQLSVCCCYYFHGWRSGLVTLPYW
R*LSESWCWISPCRACISLTRR*FIGYILMRAIA*PQVT*LATLLAVPPVR*FQPQPGNM
AVGLAFVWLARRLPWLTYWSGGEVFIVRKPQ
              
                            

Download fasta file
RegulonDB