RegulonDB RegulonDB 10.9: Amino acid Sequence
DedA family protein YqaA Amino Acid Sequence


Size: 142

Fasta

 

>DedA family protein YqaA E. coli K12. Version NC_000913.3 GI:556503834
MSEALSLFSLFASSFLSATLLPGNSEVVLVAMLLSGISHPWVLVLTATMGNSLGGLTNVI
LGRFFPLRKTSRWQEKATGWLKRYGAVTLLLSWMPVVGDLLCLLAGWMRISWGPVIFFLC
LGKALRYVAVAAATVQGMMWWH
              
                            

Download fasta file
RegulonDB