RegulonDB RegulonDB 10.9: Amino acid Sequence
membrane-bound lytic murein transglycosylase B Amino Acid Sequence


Size: 361

Fasta

 

>membrane-bound lytic murein transglycosylase B E. coli K12. Version NC_000913.3 GI:556503834
MFKRRYVTLLPLFVLLAACSSKPKPTETDTTTGTPSGGFLLEPQHNVMQMGGDFANNPNA
QQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPTTSVKPPSGPNGAWLRYRKK
FITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALAT
LSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSG
DGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGL
TPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARV
Q
              
                            

Download fasta file
RegulonDB