RegulonDB RegulonDB 10.9: Amino acid Sequence
putative DeoR-type DNA-binding transcriptional regulator YgbI Amino Acid Sequence


Size: 255

Fasta

 

>putative DeoR-type DNA-binding transcriptional regulator YgbI E. coli K12. Version NC_000913.3 GI:556503834
MIPVERRQIILEMVAEKGIVSIAELTDRMNVSHMTIRRDLQKLEQQGAVVLVSGGVQSPG
RVAHEPSHQVKTALAMTQKAAIGKLAASLVQPGSCIYLDAGTTTLAIAQHLIHMESLTVV
TNDFVIADYLLDNSNCTIIHTGGAVCRENRSCVGEAAATMLRSLMIDQAFISASSWSVRG
ISTPAEDKVTVKRAIASASRQRVLVCDATKYGQVATWLALPLSEFDQIITDDGLPESASR
ALVKQDLSLLVAKNE
              
                            

Download fasta file
RegulonDB