RegulonDB RegulonDB 10.9: Amino acid Sequence
putative L-threonate dehydrogenase Amino Acid Sequence


Size: 302

Fasta

 

>putative L-threonate dehydrogenase E. coli K12. Version NC_000913.3 GI:556503834
MKTGSEFHVGIVGLGSMGMGAALSYVRAGLSTWGADLNSNACATLKEAGACGVSDNAATF
AEKLDALLVLVVNAAQVKQVLFGETGVAQHLKPGTAVMVSSTIASADAQEIATALAGFDL
EMLDAPVSGGAVKAANGEMTVMASGSDIAFERLAPVLEAVAGKVYRIGAEPGLGSTVKII
HQLLAGVHIAAGAEAMALAARAGIPLDVMYDVVTNAAGNSWMFENRMRHVVDGDYTPHSA
VDIFVKDLGLVADTAKALHFPLPLASTALNMFTSASNAGYGKEDDSAVIKIFSGITLPGA
KS
              
                            

Download fasta file
RegulonDB