RegulonDB RegulonDB 10.9: Amino acid Sequence
putative 2-oxo-tetronate isomerase YgbM Amino Acid Sequence


Size: 258

Fasta

 

>putative 2-oxo-tetronate isomerase YgbM E. coli K12. Version NC_000913.3 GI:556503834
MPRFAANLSMMFTEVPFIERFAAARKAGFDAVEFLFPYNYSTLQIQKQLEQNHLTLALFN
TAPGDINAGEWGLSALPGREHEAHADIDLALEYALALNCEQVHVMAGVVPAGEDAERYRA
VFIDNIRYAADRFAPHGKRILVEALSPGVKPHYLFSSQYQALAIVEEVARDNVFIQLDTF
HAQKVDGNLTHLIRDYAGKYAHVQIAGLPDRHEPDDGEINYPWLFRLFDEVGYQGWIGCE
YKPRGLTEEGLGWFDAWR
              
                            

Download fasta file
RegulonDB