RegulonDB RegulonDB 10.8: Amino acid Sequence
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Amino Acid Sequence


Size: 236

Fasta

 

>2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MATTHLDVCAVVPAAGFGRRMQTECPKQYLSIGNQTILEHSVHALLAHPRVKRVVIAISP
GDSRFAQLPLANHPQITVVDGGDERADSVLAGLKAAGDAQWVLVHDAARPCLHQDDLARL
LALSETSRTGGILAAPVRDTMKRAEPGKNAIAHTVDRNGLWHALTPQFFPRELLHDCLTR
ALNEGATITDEASALEYCGFHPQLVEGRADNIKVTRPEDLALAEFYLTRTIHQENT
              
                            

Download fasta file
RegulonDB