RegulonDB RegulonDB 10.9: Amino acid Sequence
type I-E CRISPR system Cascade subunit CasB Amino Acid Sequence


Size: 160

Fasta

 

>type I-E CRISPR system Cascade subunit CasB E. coli K12. Version NC_000913.3 GI:556503834
MADEIDAMALYRAWQQLDNGSCAQIRRVSEPDELRDIPAFYRLVQPFGWENPRHQQALLR
MVFCLSAGKNVIRHQDKKSEQTTGISLGRALANSGRINERRIFQLIRADRTADMVQLRRL
LTHAEPVLDWPLMARMLTWWGKRERQQLLEDFVLTTNKNA
              
                            

Download fasta file
RegulonDB