RegulonDB RegulonDB 10.9: Amino acid Sequence
6-carboxy-5,6,7,8-tetrahydropterin synthase Amino Acid Sequence


Size: 121

Fasta

 

>6-carboxy-5,6,7,8-tetrahydropterin synthase E. coli K12. Version NC_000913.3 GI:556503834
MMSTTLFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKA
AFKPTYERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG
E
              
                            

Download fasta file
RegulonDB